Sequence 1: | NP_611561.1 | Gene: | Lapsyn / 37418 | FlyBaseID: | FBgn0034602 | Length: | 343 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
Alignment Length: | 329 | Identity: | 88/329 - (26%) |
---|---|---|---|
Similarity: | 131/329 - (39%) | Gaps: | 102/329 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 LHSAGFIIQS-EVRKCTYGHIDKLLRIR----CYDLD---LKEVPQN---LKSSVEVLDLSHNRI 70
Fly 71 RKLKTSSFQRYTDIKFLMLYDNMILSVEVGTFEPL--------------------------TSLQ 109
Fly 110 EIDLSNNGLTTIPLELFQLPRLRN---LYIDSNELTSLNLQALEKPIRAPLEYLNVAGCELQELP 171
Fly 172 D-----LGILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQLSQCGCQQVTNHLM----- 226
Fly 227 ------------------MLGASPKFVPVCLEALDIRECPL-------PY-----NRTIHSPTFA 261
Fly 262 SCQT 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lapsyn | NP_611561.1 | leucine-rich repeat | 39..59 | CDD:275380 | 8/29 (28%) |
LRR_8 | 58..118 | CDD:290566 | 24/85 (28%) | ||
leucine-rich repeat | 60..83 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 8/48 (17%) | ||
LRR_RI | <94..>249 | CDD:238064 | 50/211 (24%) | ||
LRR_8 | 106..167 | CDD:290566 | 20/63 (32%) | ||
LRR_4 | 106..145 | CDD:289563 | 15/41 (37%) | ||
leucine-rich repeat | 108..130 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 131..154 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 157..178 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | 5/22 (23%) | ||
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | 39/138 (28%) |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | 9/27 (33%) | ||
leucine-rich repeat | 225..248 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 249..307 | CDD:290566 | 18/57 (32%) | ||
leucine-rich repeat | 249..272 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | <270..479 | CDD:238064 | 55/225 (24%) | ||
leucine-rich repeat | 273..296 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 297..322 | CDD:275380 | 0/24 (0%) | ||
LRR_8 | 322..382 | CDD:290566 | 20/62 (32%) | ||
leucine-rich repeat | 323..347 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 370..428 | CDD:290566 | 18/62 (29%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 6/25 (24%) | ||
LRR_8 | 418..478 | CDD:290566 | 15/70 (21%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 8/27 (30%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 3/22 (14%) | ||
LRRCT | 476..526 | CDD:214507 | 9/31 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |