DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lapsyn and swi2

DIOPT Version :9

Sequence 1:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster


Alignment Length:217 Identity:49/217 - (22%)
Similarity:82/217 - (37%) Gaps:62/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KLLRIRCYDLDLKEVPQNLKSSVEVLDLSHNRIRK----LKTSS-----FQRYTDI-----KFLM 88
            ::|.:..|.|:||...|:.:.......|.|:.:.|    |.|.:     |.|..|.     ..|:
  Fly   248 QMLMVMHYKLELKRQCQSHEDLRNCTCLMHHILPKTHIPLYTVNCSHLQFHRLPDFLPDNTTTLV 312

  Fly    89 LYDNMILSVEVGTFEPLTS------LQEIDLSNNGLTTIP-LE-LFQLPRLRNLYIDSNELTSLN 145
            :.||||..:     .||..      :.::.|.||.::.:. || .:.|...|.|.:..|.|..|:
  Fly   313 INDNMISDI-----NPLRDNPHYRHVVDMQLENNQISNVDNLEDTYWLQNFRLLNLRGNNLRKLH 372

  Fly   146 LQALEKPI------------RAPLEYLNVAGCELQEL----PDLGILPKLWQLNASMNPLQNFRI 194
            :.||:..:            |.|.......|..::||    .|  |:...|.::.:      :|:
  Fly   373 VYALDNALDDNENANLLLLSRNPWHCTCKFGSRMRELLTKYKD--IVRDAWNVSCT------YRL 429

  Fly   195 D-----------SLANMCHLQV 205
            |           |...||:|.|
  Fly   430 DDDQLLAKVLTLSRQEMCNLSV 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LapsynNP_611561.1 leucine-rich repeat 39..59 CDD:275380 6/19 (32%)
LRR_8 58..118 CDD:290566 18/79 (23%)
leucine-rich repeat 60..83 CDD:275380 7/31 (23%)
leucine-rich repeat 84..107 CDD:275380 7/27 (26%)
LRR_RI <94..>249 CDD:238064 31/147 (21%)
LRR_8 106..167 CDD:290566 16/80 (20%)
LRR_4 106..145 CDD:289563 10/46 (22%)
leucine-rich repeat 108..130 CDD:275380 6/23 (26%)
leucine-rich repeat 131..154 CDD:275380 7/34 (21%)
leucine-rich repeat 157..178 CDD:275380 5/24 (21%)
leucine-rich repeat 179..202 CDD:275380 5/33 (15%)
swi2NP_611247.3 LRR <117..384 CDD:227223 34/140 (24%)
leucine-rich repeat 132..154 CDD:275378
leucine-rich repeat 155..178 CDD:275378
leucine-rich repeat 179..201 CDD:275378
leucine-rich repeat 202..214 CDD:275378
leucine-rich repeat 287..307 CDD:275378 5/19 (26%)
leucine-rich repeat 308..332 CDD:275378 7/28 (25%)
leucine-rich repeat 333..357 CDD:275378 6/23 (26%)
leucine-rich repeat 358..385 CDD:275378 7/26 (27%)
leucine-rich repeat 386..398 CDD:275378 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.