| Sequence 1: | NP_611561.1 | Gene: | Lapsyn / 37418 | FlyBaseID: | FBgn0034602 | Length: | 343 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
| Alignment Length: | 203 | Identity: | 59/203 - (29%) |
|---|---|---|---|
| Similarity: | 98/203 - (48%) | Gaps: | 8/203 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 42 IRCYDLDLKEVPQNLKSSVEVLDLSHNRIRKLKTSSFQR--YTDIKFLMLYDNMILSVEVGTFEP 104
Fly 105 LTSLQEIDLSNNGLTTIP-LELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEYLNVAGCELQ 168
Fly 169 EL--PDLGILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQ-LSQCGCQQVTNHLMMLGA 230
Fly 231 SPKFVPVC 238 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lapsyn | NP_611561.1 | leucine-rich repeat | 39..59 | CDD:275380 | 4/16 (25%) |
| LRR_8 | 58..118 | CDD:290566 | 22/61 (36%) | ||
| leucine-rich repeat | 60..83 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 7/22 (32%) | ||
| LRR_RI | <94..>249 | CDD:238064 | 45/149 (30%) | ||
| LRR_8 | 106..167 | CDD:290566 | 23/61 (38%) | ||
| LRR_4 | 106..145 | CDD:289563 | 18/39 (46%) | ||
| leucine-rich repeat | 108..130 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 131..154 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 157..178 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 179..202 | CDD:275380 | 4/22 (18%) | ||
| kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 4/16 (25%) |
| LRR_RI | <119..277 | CDD:238064 | 48/159 (30%) | ||
| leucine-rich repeat | 123..148 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 148..207 | CDD:290566 | 25/58 (43%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 195..255 | CDD:290566 | 17/61 (28%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 245..268 | CDD:275380 | 4/22 (18%) | ||
| LRRCT | 277..327 | CDD:214507 | 7/29 (24%) | ||
| IG_like | 338..429 | CDD:214653 | |||
| Ig | 346..426 | CDD:143165 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24366 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||