DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lapsyn and kek1

DIOPT Version :10

Sequence 1:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster


Alignment Length:203 Identity:59/203 - (29%)
Similarity:98/203 - (48%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IRCYDLDLKEVPQNLKSSVEVLDLSHNRIRKLKTSSFQR--YTDIKFLMLYDNMILSVEVGTFEP 104
            :.|.|..|.::|:::..:.:|||:|.|:::.|....|.|  ..:::.|.|.:..|..:|..||:.
  Fly   105 VECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKG 169

  Fly   105 LTSLQEIDLSNNGLTTIP-LELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEYLNVAGCELQ 168
            ||:|.|:|||:|.|.|:| |.|..:|.||.|.:.||.:..:..||...  ...|..|:::.|::|
  Fly   170 LTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGN--TPSLHKLDLSHCDIQ 232

  Fly   169 EL--PDLGILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQ-LSQCGCQQVTNHLMMLGA 230
            .:  ...|.|..|..|..:.|.|......::..:..|..|:|..:. |..|..:.....||....
  Fly   233 TISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNI 297

  Fly   231 SPKFVPVC 238
            .....|||
  Fly   298 PYPVAPVC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LapsynNP_611561.1 LRR <34..>214 CDD:443914 52/177 (29%)
leucine-rich repeat 39..59 CDD:275380 4/16 (25%)
leucine-rich repeat 60..83 CDD:275380 8/24 (33%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..130 CDD:275380 11/22 (50%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
leucine-rich repeat 157..178 CDD:275380 6/22 (27%)
leucine-rich repeat 179..202 CDD:275380 4/22 (18%)
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 4/16 (25%)
LRR <122..>277 CDD:443914 48/156 (31%)
leucine-rich repeat 123..148 CDD:275380 8/24 (33%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 11/22 (50%)
leucine-rich repeat 197..220 CDD:275380 7/24 (29%)
leucine-rich repeat 221..244 CDD:275380 6/22 (27%)
leucine-rich repeat 245..268 CDD:275380 4/22 (18%)
LRRCT 277..327 CDD:214507 7/29 (24%)
IG_like 338..429 CDD:214653
Ig strand B 346..350 CDD:409353
Ig strand C 359..363 CDD:409353
Ig strand E 395..399 CDD:409353
Ig strand F 409..414 CDD:409353
Ig strand G 422..425 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.