Sequence 1: | NP_611561.1 | Gene: | Lapsyn / 37418 | FlyBaseID: | FBgn0034602 | Length: | 343 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510491.2 | Gene: | iglr-1 / 184720 | WormBaseID: | WBGene00008977 | Length: | 695 | Species: | Caenorhabditis elegans |
Alignment Length: | 228 | Identity: | 59/228 - (25%) |
---|---|---|---|
Similarity: | 90/228 - (39%) | Gaps: | 68/228 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 HIDKLLRIRCYDLDLKEVPQNL---KSSVEVLDLSHNRIRKLKTSSFQRYTDIKFLMLYDNMILS 96
Fly 97 VEVGTFEPLTSLQEIDLSNNGLTTIPLELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEYLN 161
Fly 162 VAGCELQELPDLGILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQLSQCGCQQVTNHLM 226
Fly 227 MLGASPKFVPV-CLEALDIRECPLPYNRTIHSP 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lapsyn | NP_611561.1 | leucine-rich repeat | 39..59 | CDD:275380 | 2/22 (9%) |
LRR_8 | 58..118 | CDD:290566 | 22/59 (37%) | ||
leucine-rich repeat | 60..83 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | <94..>249 | CDD:238064 | 39/155 (25%) | ||
LRR_8 | 106..167 | CDD:290566 | 11/60 (18%) | ||
LRR_4 | 106..145 | CDD:289563 | 11/38 (29%) | ||
leucine-rich repeat | 108..130 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 131..154 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 157..178 | CDD:275380 | 0/20 (0%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | 8/22 (36%) | ||
iglr-1 | NP_510491.2 | LRR | <104..325 | CDD:227223 | 59/228 (26%) |
leucine-rich repeat | 106..128 | CDD:275380 | |||
leucine-rich repeat | 129..151 | CDD:275380 | 2/2 (100%) | ||
leucine-rich repeat | 152..175 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 176..199 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 200..223 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 224..247 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 248..270 | CDD:275380 | 11/72 (15%) | ||
leucine-rich repeat | 271..294 | CDD:275380 | 9/30 (30%) | ||
leucine-rich repeat | 295..316 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |