DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lapsyn and islr2

DIOPT Version :10

Sequence 1:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001120371.1 Gene:islr2 / 100145445 XenbaseID:XB-GENE-5920691 Length:691 Species:Xenopus tropicalis


Alignment Length:189 Identity:46/189 - (24%)
Similarity:74/189 - (39%) Gaps:39/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTYGHIDKLLRIRCYDLDLKEVPQNLKSSVEVLDLSHNRIRKLKTSSFQRYTDIKFLMLYDNMIL 95
            |||..:.|             :|....|:|..|.||.|:|..||.|.|.....:..|.|..|.|.
 Frog    37 CTYKKLQK-------------IPSGFPSNVTTLSLSANKITSLKKSDFIGVPQVTSLWLAHNEIS 88

  Fly    96 SVEVGTFEPLTSLQEIDLSNNGLTTIP-LELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEY 159
            .:|.|....:.:|:.:|:|:|.|...| .:|..|..|:.:.:::|.:.:|...|.:         
 Frog    89 EIEEGALATMVNLKNLDVSHNLLVEFPWRDLASLSALQLIKMNNNRMVNLPRDAFQ--------- 144

  Fly   160 LNVAGCELQELPDLGILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQLSQCGC 218
                  .|.||..|.|      .|...:.:|......|.::.|:|:.    :....|.|
 Frog   145 ------NLNELKSLRI------NNNQFSVIQEGTFKPLISLSHIQIY----NNPFHCSC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LapsynNP_611561.1 LRR <34..>214 CDD:443914 41/180 (23%)
leucine-rich repeat 39..59 CDD:275380 1/19 (5%)
leucine-rich repeat 60..83 CDD:275380 10/22 (45%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..130 CDD:275380 8/22 (36%)
leucine-rich repeat 131..154 CDD:275380 4/22 (18%)
leucine-rich repeat 157..178 CDD:275380 5/20 (25%)
leucine-rich repeat 179..202 CDD:275380 3/22 (14%)
islr2NP_001120371.1 LRR <36..>228 CDD:443914 46/189 (24%)
leucine-rich repeat 36..52 CDD:275380 5/27 (19%)
leucine-rich repeat 53..76 CDD:275380 10/22 (45%)
leucine-rich repeat 77..100 CDD:275380 6/22 (27%)
leucine-rich repeat 101..124 CDD:275380 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 5/37 (14%)
leucine-rich repeat 149..172 CDD:275380 6/28 (21%)
Ig 251..332 CDD:472250
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 307..311 CDD:409353
Ig strand F 321..326 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.