DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tud and LCL3

DIOPT Version :9

Sequence 1:NP_476773.1 Gene:tud / 37417 FlyBaseID:FBgn0003891 Length:2515 Species:Drosophila melanogaster
Sequence 2:NP_011430.1 Gene:LCL3 / 852795 SGDID:S000003053 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:58/292 - (19%)
Similarity:94/292 - (32%) Gaps:98/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1171 SNTSSTCSYTV-NIFVNGASLRDMLVKAEFLTEV--APEIRVNLLAGQQIRGKFTSIRDMTSFKV 1232
            ||:..:....| :|.:.|::|..:.....:||:.  ..:|...:.....:.||.||:.|      
Yeast     6 SNSKKSADVAVLSIILTGSTLTLIYTYKRYLTQFKRTNDIPRRIFRKHWLYGKVTSVGD------ 64

  Fly  1233 QFDYGNNVNF-------------------LCTYDDA--KFVKSNPNLARRFKEFYEGKSFALNVK 1276
                |:|.:|                   :...|..  |.|..:.|:  ||..|           
Yeast    65 ----GDNFHFFHMPGGIRGGWGWLRPVPQMIKNDSTAEKLVGDSRNM--RFFNF----------- 112

  Fly  1277 NVCENNIVHLRPVMPLFMEDRRSFI---CPY---------PVVLSSFQALVVYTAKPYRVY---- 1325
                |.|.|.|.......:.:..|:   .||         |:.|....|       |.|.:    
Yeast   113 ----NWITHGRSTKSKIQKAKSQFLKLNVPYKNRKNLPTIPIRLCGIDA-------PERAHFGNP 166

  Fly  1326 VQP---QAIVPSMQTLLDNMYEHYKAKGDSLKKFDVGQI--CAVRSSDGNWYRARISGKDSNAAC 1385
            .||   :|::.....:|        .|...:|...:.|.  |..|.|..:|:.   ..||.:...
Yeast   167 AQPFGNEALIWLQNRIL--------GKKVWVKPLSIDQYNRCVARVSYWDWFG---GWKDLSLEM 220

  Fly  1386 FE----VFYIDYGNTEEIKRDDIKALDAKFYE 1413
            .:    |.|....|||...|:|    ..::||
Yeast   221 LKDGLAVVYEGKVNTEFDDRED----KYRYYE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tudNP_476773.1 DUF1421 198..>397 CDD:284607
TUDOR 406..524 CDD:278965
TUDOR 454..510 CDD:197660
TUDOR 591..707 CDD:278965
TUDOR 644..693 CDD:197660
TUDOR 1012..1132 CDD:278965
TUDOR 1062..1119 CDD:197660
TUDOR 1309..1425 CDD:278965 25/118 (21%)
TUDOR 1354..1411 CDD:197660 15/62 (24%)
TUDOR 1614..1727 CDD:278965
TUDOR 1666..1711 CDD:119391
TUDOR 1791..1906 CDD:278965
TUDOR 1843..1886 CDD:119391
TUDOR 1975..2089 CDD:278965
TUDOR 2028..2069 CDD:119391
TUDOR 2159..2277 CDD:278965
TUDOR 2210..2264 CDD:197660
TUDOR 2345..2458 CDD:278965
TUDOR 2396..2437 CDD:119391
LCL3NP_011430.1 SNase 149..261 CDD:395448 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.