DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tud and TDRD10

DIOPT Version :9

Sequence 1:NP_476773.1 Gene:tud / 37417 FlyBaseID:FBgn0003891 Length:2515 Species:Drosophila melanogaster
Sequence 2:XP_011507454.1 Gene:TDRD10 / 126668 HGNCID:25316 Length:398 Species:Homo sapiens


Alignment Length:172 Identity:41/172 - (23%)
Similarity:63/172 - (36%) Gaps:51/172 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 VVISYVENGPYLFWVHLKSSDHDLSTMMGQIERTKLKALAQAPE-----------LGTACVARF- 466
            :|.|.|...|:.:.:|:..:.|       |..:.....||||.|           .||.|:|.: 
Human   231 LVTSIVPKTPFFWAMHVTEALH-------QNMQALFSTLAQAEEQQPYLEGSTVMRGTRCLAEYH 288

  Fly   467 -SEDGH-------LYRAMVCAVYAQRYRVVYVDYG--------NSELLSASDLFQIPPELLEIKP 515
             .:.||       |.|....||      |:::|:|        :...|.:.|.:.|||   ..:|
Human   289 LGDYGHAWNRCWVLDRVDTWAV------VMFIDFGQLATIPVQSLRSLDSDDFWTIPP---LTQP 344

  Fly   516 FAFRFALAGTKEIEPIDDSMKRIFKKSAIYRNFELTVQAPES 557
            |.....:..:.|:      :.||. |..|.......|.||.|
Human   345 FMLEKDILSSYEV------VHRIL-KGKITGALNSAVTAPAS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tudNP_476773.1 DUF1421 198..>397 CDD:284607
TUDOR 406..524 CDD:278965 32/137 (23%)
TUDOR 454..510 CDD:197660 21/83 (25%)
TUDOR 591..707 CDD:278965
TUDOR 644..693 CDD:197660
TUDOR 1012..1132 CDD:278965
TUDOR 1062..1119 CDD:197660
TUDOR 1309..1425 CDD:278965
TUDOR 1354..1411 CDD:197660
TUDOR 1614..1727 CDD:278965
TUDOR 1666..1711 CDD:119391
TUDOR 1791..1906 CDD:278965
TUDOR 1843..1886 CDD:119391
TUDOR 1975..2089 CDD:278965
TUDOR 2028..2069 CDD:119391
TUDOR 2159..2277 CDD:278965
TUDOR 2210..2264 CDD:197660
TUDOR 2345..2458 CDD:278965
TUDOR 2396..2437 CDD:119391
TDRD10XP_011507454.1 RRM <7..>135 CDD:223796
RRM_SF 77..134 CDD:302621
TUDOR <251..347 CDD:278965 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.