DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pu and FOL2

DIOPT Version :9

Sequence 1:NP_726038.1 Gene:Pu / 37415 FlyBaseID:FBgn0003162 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_011783.1 Gene:FOL2 / 853183 SGDID:S000003499 Length:243 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:117/230 - (50%)
Similarity:157/230 - (68%) Gaps:32/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 HDLELDHKPPTREALLPDMAR------------------------------SYRLLLGGLGENPD 160
            |:..|:.:|.:...|.|.:.|                              :.:.:|..|||:.:
Yeast    13 HETPLNIRPTSPYTLNPPVERDGFSWPSVGTRQRAEETEEEEKERIQRISGAIKTILTELGEDVN 77

  Fly   161 RQGLIKTPERAAKAMLYFTKGYDQS-LEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGK 224
            |:||:.||:|.|||||||||||..: ::||:..|||:|||||||:|:|||::|:||||||||:||
Yeast    78 REGLLDTPQRYAKAMLYFTKGYQTNIMDDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGK 142

  Fly   225 VSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMR 289
            |.|||:|..|::|||||||:.|:::||||||||||||||:|::..::|.|||||:|..|||||.|
Yeast   143 VHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTKQIAMALSDILKPLGVAVVMEASHMCMVSR 207

  Fly   290 GVQKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK 324
            |:||..|.||||.|||.||.. |||||||.|:..:
Yeast   208 GIQKTGSSTVTSCMLGGFRAH-KTREEFLTLLGRR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuNP_726038.1 GTP_cyclohydro1 141..323 CDD:238349 113/212 (53%)
FOL2NP_011783.1 folE 61..240 CDD:129173 111/179 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343951
Domainoid 1 1.000 227 1.000 Domainoid score I425
eggNOG 1 0.900 - - E1_COG0302
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H132
Inparanoid 1 1.050 227 1.000 Inparanoid score I745
Isobase 1 0.950 - 0 Normalized mean entropy S627
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002669
OrthoInspector 1 1.000 - - oto100377
orthoMCL 1 0.900 - - OOG6_101153
Panther 1 1.100 - - LDO PTHR11109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R477
SonicParanoid 1 1.000 - - X2044
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.