DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pu and AT3G07270

DIOPT Version :9

Sequence 1:NP_726038.1 Gene:Pu / 37415 FlyBaseID:FBgn0003162 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_187383.1 Gene:AT3G07270 / 819915 AraportID:AT3G07270 Length:466 Species:Arabidopsis thaliana


Alignment Length:203 Identity:76/203 - (37%)
Similarity:118/203 - (58%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLN 191
            :|..:|:|.|  ..:.|   :.:|||.||.|:.:|:|:.|||.|.|||:...|:||.|.::|.:.
plant    23 ELAFEHQPET--LAIQD---AVKLLLQGLHEDVNREGIKKTPFRVAKALREGTRGYKQKVKDYVQ 82

  Fly   192 GAVFDE-DHDE----------MVVVKDIEMFSMCEHHLVPFYGKVSIGYLPC-NKILGLSKLARI 244
            .|:|.| ..||          :|||:|::.:|.||..|:||:.|..|||:|. .::|||||.:|:
plant    83 SALFPEAGLDEGVGQAGGVGGLVVVRDLDHYSYCESCLLPFHVKCHIGYVPSGQRVLGLSKFSRV 147

  Fly   245 VEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKIN-------SKTVTST 302
            .::|::|||..:||...|..|:...|:|||||||:|..|:......:..:|       .|.:.|:
plant   148 TDVFAKRLQDPQRLADDICSALQHWVKPAGVAVVLECSHIHFPSLDLDSLNLSSHRGFVKLLVSS 212

  Fly   303 MLGVFRDD 310
            ..|||.|:
plant   213 GSGVFEDE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuNP_726038.1 GTP_cyclohydro1 141..323 CDD:238349 72/189 (38%)
AT3G07270NP_187383.1 PLN02531 1..460 CDD:215290 76/203 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2070
eggNOG 1 0.900 - - E1_COG0302
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D793457at2759
OrthoFinder 1 1.000 - - FOG0002669
OrthoInspector 1 1.000 - - oto4124
orthoMCL 1 0.900 - - OOG6_101153
Panther 1 1.100 - - LDO PTHR11109
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2044
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.