DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pu and gch1

DIOPT Version :9

Sequence 1:NP_726038.1 Gene:Pu / 37415 FlyBaseID:FBgn0003162 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001006789.1 Gene:gch1 / 448485 XenbaseID:XB-GENE-961365 Length:247 Species:Xenopus tropicalis


Alignment Length:214 Identity:145/214 - (67%)
Similarity:169/214 - (78%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 STTP----GHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKA 174
            ||.|    ..|:.....|.||:         ||.:|.:|..:|..|||:|.||||:|||.|||.|
 Frog    43 STPPVDTWREERARSEEDNELN---------LPSLATAYGTILRALGEDPGRQGLLKTPWRAATA 98

  Fly   175 MLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLS 239
            |.||||||.:::.||||.|:|||||||||:||||:||||||||||||.|||.|||||..::||||
 Frog    99 MQYFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLGLS 163

  Fly   240 KLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTML 304
            ||||||||:|||||||||||||||:|:|:|:.|:||.||||..|||||||||||:||||||||||
 Frog   164 KLARIVEIYSRRLQVQERLTKQIAIAITEALHPSGVGVVVEATHMCMVMRGVQKMNSKTVTSTML 228

  Fly   305 GVFRDDPKTREEFLNLVNS 323
            ||||:|||||||||.|:.|
 Frog   229 GVFREDPKTREEFLTLIRS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuNP_726038.1 GTP_cyclohydro1 141..323 CDD:238349 137/181 (76%)
gch1NP_001006789.1 GTP_cyclohydro1 63..247 CDD:238349 138/192 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1684
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H132
Inparanoid 1 1.050 286 1.000 Inparanoid score I2785
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D529046at33208
OrthoFinder 1 1.000 - - FOG0002669
OrthoInspector 1 1.000 - - otm49517
Panther 1 1.100 - - O PTHR11109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R477
SonicParanoid 1 1.000 - - X2044
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.