DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pu and Gch1

DIOPT Version :9

Sequence 1:NP_726038.1 Gene:Pu / 37415 FlyBaseID:FBgn0003162 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_077332.1 Gene:Gch1 / 29244 RGDID:61992 Length:241 Species:Rattus norvegicus


Alignment Length:261 Identity:155/261 - (59%)
Similarity:184/261 - (70%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDSDGTQPKTPL---TPRTSTTPGHEKCTFHHD 127
            |.|..|: |.|.....|...||          |::.|.||....   .||:           ..|
  Rat    12 GFPEREL-PRPGASRPAEKSRP----------PEAKGAQPADAWKAGRPRS-----------EED 54

  Fly   128 LELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNG 192
            .||:         ||::|.:|..:|..|||:|.||||:|||.|||.||.:|||||.:::.||||.
  Rat    55 NELN---------LPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLND 110

  Fly   193 AVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQER 257
            |:|||||||||:||||:||||||||||||.|:|.|||||..::||||||||||||:|||||||||
  Rat   111 AIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQER 175

  Fly   258 LTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVN 322
            ||||||||:|:|:|||||.||:|..|||||||||||:||||||||||||||:|||||||||.|:.
  Rat   176 LTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIR 240

  Fly   323 S 323
            |
  Rat   241 S 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuNP_726038.1 GTP_cyclohydro1 141..323 CDD:238349 137/181 (76%)
Gch1NP_077332.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 16/67 (24%)
GTP_cyclohydro1 57..241 CDD:238349 138/192 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341481
Domainoid 1 1.000 279 1.000 Domainoid score I1628
eggNOG 1 0.900 - - E1_COG0302
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H132
Inparanoid 1 1.050 289 1.000 Inparanoid score I2732
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D529046at33208
OrthoFinder 1 1.000 - - FOG0002669
OrthoInspector 1 1.000 - - oto98872
orthoMCL 1 0.900 - - OOG6_101153
Panther 1 1.100 - - O PTHR11109
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2044
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.