DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pu and LOC100496565

DIOPT Version :9

Sequence 1:NP_726038.1 Gene:Pu / 37415 FlyBaseID:FBgn0003162 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002932426.2 Gene:LOC100496565 / 100496565 -ID:- Length:228 Species:Xenopus tropicalis


Alignment Length:235 Identity:137/235 - (58%)
Similarity:171/235 - (72%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KTNGSSPDSDGTQPKTPLTP---RTSTTPGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLG 153
            :.|||...:..:..|..|.|   ..|...|||:          .|....|       |:|..:|.
 Frog    11 EANGSHVSTYSSDLKKGLKPDKANQSNREGHEQ----------EKAGAIE-------RAYSTILR 58

  Fly   154 GLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHL 218
            .|||||:|:||:.||.||||||.:.||||.:::.||:|.|||||||||:|:||||::||:|||||
 Frog    59 ELGENPEREGLLLTPSRAAKAMQFLTKGYKETVYDVMNNAVFDEDHDEIVIVKDIDIFSLCEHHL 123

  Fly   219 VPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVH 283
            |||:|||.|||:|..|::||||||||.||:|||||||||||||||.|:.:|:||.|||||:|..|
 Frog   124 VPFFGKVHIGYIPNKKVVGLSKLARIAEIYSRRLQVQERLTKQIAFAILEALQPIGVAVVMEASH 188

  Fly   284 MCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVNS 323
            |||||||||||||:|:||||.|||.:|||||||||:|:.:
 Frog   189 MCMVMRGVQKINSRTITSTMHGVFLEDPKTREEFLSLIKA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuNP_726038.1 GTP_cyclohydro1 141..323 CDD:238349 125/181 (69%)
LOC100496565XP_002932426.2 GTP_cyclohydro1 49..227 CDD:238349 126/184 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1684
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D529046at33208
OrthoFinder 1 1.000 - - FOG0002669
OrthoInspector 1 1.000 - - otm49517
Panther 1 1.100 - - LDO PTHR11109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R477
SonicParanoid 1 1.000 - - X2044
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.