DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pu and gch1

DIOPT Version :9

Sequence 1:NP_726038.1 Gene:Pu / 37415 FlyBaseID:FBgn0003162 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001129727.2 Gene:gch1 / 100192219 ZFINID:ZDB-GENE-070720-5 Length:251 Species:Danio rerio


Alignment Length:186 Identity:139/186 - (74%)
Similarity:162/186 - (87%) Gaps:0/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 EALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEM 202
            |..||.:|.:|..:|.||||:|.||||:|||.|||.||.:|||||.:.:.||||.|:||||||||
Zfish    66 EMSLPSIAAAYTTILRGLGEDPQRQGLLKTPWRAATAMQFFTKGYQEKIIDVLNDAIFDEDHDEM 130

  Fly   203 VVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVT 267
            |:||||:|||||||||||.:|:|.|||||..::||||||||||||:|||||||||||||||||:|
Zfish   131 VIVKDIDMFSMCEHHLVPIFGRVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAIT 195

  Fly   268 QAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVNS 323
            :|:|||||.||||..|||||||||||:||||||||||||||:|||||:|||.|:.|
Zfish   196 EALQPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRDEFLTLIRS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuNP_726038.1 GTP_cyclohydro1 141..323 CDD:238349 137/181 (76%)
gch1NP_001129727.2 GTP_cyclohydro1 67..251 CDD:238349 137/183 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581486
Domainoid 1 1.000 279 1.000 Domainoid score I1663
eggNOG 1 0.900 - - E1_COG0302
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H132
Inparanoid 1 1.050 287 1.000 Inparanoid score I2820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D529046at33208
OrthoFinder 1 1.000 - - FOG0002669
OrthoInspector 1 1.000 - - otm26069
orthoMCL 1 0.900 - - OOG6_101153
Panther 1 1.100 - - O PTHR11109
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2044
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.