DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xpd and AT2G05635

DIOPT Version :9

Sequence 1:NP_726036.2 Gene:Xpd / 37414 FlyBaseID:FBgn0261850 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001318203.1 Gene:AT2G05635 / 2745433 AraportID:AT2G05635 Length:146 Species:Arabidopsis thaliana


Alignment Length:33 Identity:13/33 - (39%)
Similarity:16/33 - (48%) Gaps:7/33 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VEHPETVRK-------LIYCSRTVPEIEKVIAE 86
            ||..||..|       :.|.|||..:|.:||.|
plant    81 VEKAETATKKRTKIPTIYYASRTHSQITQVIRE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XpdNP_726036.2 rad3 7..717 CDD:273169 13/33 (39%)
DEXDc2 8..280 CDD:214693 13/33 (39%)
HBB 270..413 CDD:284245
HELICc2 542..686 CDD:214694
AT2G05635NP_001318203.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186062at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.