powered by:
Protein Alignment LSm1 and LSM7
DIOPT Version :9
Sequence 1: | NP_611559.1 |
Gene: | LSm1 / 37413 |
FlyBaseID: | FBgn0261067 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014252.2 |
Gene: | LSM7 / 855575 |
SGDID: | S000005091 |
Length: | 115 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 35/72 - (48%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 DKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDI--------PRGVFIIRGENV 74
|.|:.|.|..|:.:||.|:..||..||||..|:|.:...::..:. ..|:.:|||..:
Yeast 35 DSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNARKLGLTVIRGTIL 99
Fly 75 VLLGEID 81
|.|...:
Yeast 100 VSLSSAE 106
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
LSm1 | NP_611559.1 |
LSm1 |
7..80 |
CDD:212475 |
22/69 (32%) |
LSM7 | NP_014252.2 |
LSm7 |
24..115 |
CDD:212476 |
22/72 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.