DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and LSM3A

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_173542.1 Gene:LSM3A / 838714 AraportID:AT1G21190 Length:97 Species:Arabidopsis thaliana


Alignment Length:71 Identity:21/71 - (29%)
Similarity:37/71 - (52%) Gaps:10/71 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VDKKLMVLLRDGRTLIGYLRSVDQFANLVL---QRTIERIHVGNE-YGDIPRGV------FIIRG 71
            :::::.|.||..|.|.|.|.:.||..|::|   :..|..|.:.:| |.:|.|..      ..:||
plant    20 IEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIEIDDETYEEIVRTTKRTVPFLFVRG 84

  Fly    72 ENVVLL 77
            :.|:|:
plant    85 DGVILV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 21/71 (30%)
LSM3ANP_173542.1 LSm3 11..92 CDD:212477 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.