powered by:
Protein Alignment LSm1 and LSM3A
DIOPT Version :9
Sequence 1: | NP_611559.1 |
Gene: | LSm1 / 37413 |
FlyBaseID: | FBgn0261067 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_173542.1 |
Gene: | LSM3A / 838714 |
AraportID: | AT1G21190 |
Length: | 97 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 37/71 - (52%) |
Gaps: | 10/71 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 VDKKLMVLLRDGRTLIGYLRSVDQFANLVL---QRTIERIHVGNE-YGDIPRGV------FIIRG 71
:::::.|.||..|.|.|.|.:.||..|::| :..|..|.:.:| |.:|.|.. ..:||
plant 20 IEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIEIDDETYEEIVRTTKRTVPFLFVRG 84
Fly 72 ENVVLL 77
:.|:|:
plant 85 DGVILV 90
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
LSm1 | NP_611559.1 |
LSm1 |
7..80 |
CDD:212475 |
21/71 (30%) |
LSM3A | NP_173542.1 |
LSm3 |
11..92 |
CDD:212477 |
21/71 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.