DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and LSM1A

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_564072.1 Gene:LSM1A / 838495 AraportID:AT1G19120 Length:128 Species:Arabidopsis thaliana


Alignment Length:94 Identity:56/94 - (59%)
Similarity:71/94 - (75%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIRGENVVLLGEID 81
            :||||:|||||||.|:|.|||.|||||.||:...||:.||:.|.|||.|::|||||||||:||:|
plant    19 LDKKLLVLLRDGRKLMGLLRSFDQFANAVLEEAYERVIVGDLYCDIPLGLYIIRGENVVLIGELD 83

  Fly    82 REKEQKLPLKEISVD--EILDAQRREQEQ 108
            .|||: ||...:.|.  ||..||:.|:|:
plant    84 VEKEE-LPAHMVQVPEAEIKRAQKAEKEE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 42/62 (68%)
LSM1ANP_564072.1 LSm1 9..82 CDD:212475 42/62 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2787
eggNOG 1 0.900 - - E1_KOG1782
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I2157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508864at2759
OrthoFinder 1 1.000 - - FOG0004320
OrthoInspector 1 1.000 - - otm3472
orthoMCL 1 0.900 - - OOG6_102846
Panther 1 1.100 - - O PTHR15588
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3053
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.