DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and SNRNP-G

DIOPT Version :10

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_179971.1 Gene:SNRNP-G / 816925 AraportID:AT2G23930 Length:80 Species:Arabidopsis thaliana


Alignment Length:69 Identity:27/69 - (39%)
Similarity:43/69 - (62%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIRGENVVLL 77
            |.:.:||||.:.|...|.:.|.||..|||.|||:..|:| :: ||:..||  |:.:|||.::|.:
plant    10 LKKYMDKKLQIKLNANRMVTGTLRGFDQFMNLVVDNTVE-VN-GNDKTDI--GMVVIRGNSIVTV 70

  Fly    78 GEID 81
            ..::
plant    71 EALE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 27/66 (41%)
SNRNP-GNP_179971.1 Sm_G 6..74 CDD:212466 27/67 (40%)

Return to query results.
Submit another query.