DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and SNRPG

DIOPT Version :10

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001304094.1 Gene:SNRPG / 6637 HGNCID:11163 Length:96 Species:Homo sapiens


Alignment Length:87 Identity:25/87 - (28%)
Similarity:36/87 - (41%) Gaps:24/87 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AH---LLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIRGE 72
            ||   |.:.:||||.:.|..||.:.|.||..|.|.|||:...:|....|.:..            
Human     4 AHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNN------------ 56

  Fly    73 NVVLLGEIDREKEQKLPLKEIS 94
                :|.:|     .:|.|.:|
Human    57 ----IGMVD-----NIPNKAVS 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 21/71 (30%)
SNRPGNP_001304094.1 Sm_G 5..>60 CDD:212466 20/70 (29%)

Return to query results.
Submit another query.