DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and lsm1

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001011191.1 Gene:lsm1 / 496613 XenbaseID:XB-GENE-971223 Length:133 Species:Xenopus tropicalis


Alignment Length:132 Identity:83/132 - (62%)
Similarity:110/132 - (83%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNPLAGTAHLLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFI 68
            :|.:.|||.|:|::|||.:|||||||||||||||:||||||||.:|:||||||.:|||||||:|:
 Frog     1 MNYMPGTASLIEDIDKKHLVLLRDGRTLIGYLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFV 65

  Fly    69 IRGENVVLLGEIDREKEQKLPLKEISVDEILDAQRREQEQRQEKHRLVSKALKERGLAVD-ANII 132
            :||||||||||||.|||...||.::|::|||:.||.||:.:.|..:|..:|||||||::. |:.:
 Frog    66 VRGENVVLLGEIDLEKESDTPLLQVSIEEILEDQRVEQQSKNEAEKLKVQALKERGLSIPRADTL 130

  Fly   133 NE 134
            :|
 Frog   131 DE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 55/72 (76%)
lsm1NP_001011191.1 LSm1 4..77 CDD:212475 55/72 (76%)
Rotamase_2 <64..131 CDD:330945 36/66 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6089
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40945
Inparanoid 1 1.050 172 1.000 Inparanoid score I3978
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508864at2759
OrthoFinder 1 1.000 - - FOG0004320
OrthoInspector 1 1.000 - - oto103931
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R665
SonicParanoid 1 1.000 - - X3053
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.