DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and CG2021

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster


Alignment Length:80 Identity:26/80 - (32%)
Similarity:43/80 - (53%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIH---VGNEYGDIPRGVFIIRGENVVLLG 78
            ::..:.::..|||..||.|:..||..|:::....||:.   .|.|  .|..|:.||||:|:.::|
  Fly     8 INHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSGIE--QIVLGLHIIRGDNIAVIG 70

  Fly    79 EIDREKEQKLPLKEI 93
            .||...:.:|.|..|
  Fly    71 LIDETIDSRLDLANI 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 21/65 (32%)
CG2021NP_647660.1 LSm8 1..91 CDD:212474 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15588
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.