DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and Lsm1

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001102346.1 Gene:Lsm1 / 364624 RGDID:1304967 Length:133 Species:Rattus norvegicus


Alignment Length:132 Identity:82/132 - (62%)
Similarity:111/132 - (84%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNPLAGTAHLLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFI 68
            :|.:.|||.|:|::|||.:|||||||||||:|||:||||||||.:|:||||||.:|||||||:|:
  Rat     1 MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGRKYGDIPRGIFV 65

  Fly    69 IRGENVVLLGEIDREKEQKLPLKEISVDEILDAQRREQEQRQEKHRLVSKALKERGLAVD-ANII 132
            :||||||||||||.|||...||:::|::|||:.||.||:.|.|..:|..:|||:|||::. |:.:
  Rat    66 VRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQSRLEAEKLKVQALKDRGLSIPRADTL 130

  Fly   133 NE 134
            :|
  Rat   131 DE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 54/72 (75%)
Lsm1NP_001102346.1 LSm1 4..77 CDD:212475 54/72 (75%)
PRK10788 <64..131 CDD:182731 36/66 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341707
Domainoid 1 1.000 112 1.000 Domainoid score I6076
eggNOG 1 0.900 - - E1_KOG1782
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40945
Inparanoid 1 1.050 171 1.000 Inparanoid score I4027
OMA 1 1.010 - - QHG55192
OrthoDB 1 1.010 - - D1508864at2759
OrthoFinder 1 1.000 - - FOG0004320
OrthoInspector 1 1.000 - - oto97248
orthoMCL 1 0.900 - - OOG6_102846
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3053
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.