DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and Lsm3

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001100081.1 Gene:Lsm3 / 297455 RGDID:1305971 Length:102 Species:Rattus norvegicus


Alignment Length:86 Identity:24/86 - (27%)
Similarity:44/86 - (51%) Gaps:18/86 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TAHLLEE--------VDKKLMVLLRDGRTLIGYLRSVDQFANLVL---QRTIERIHVGNE-YGDI 62
            |.:.:||        :|:::.|.:|:.|.|.|.|.:.||..|::|   :.|:..|.:..| |.:|
  Rat    10 TTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEI 74

  Fly    63 PRG------VFIIRGENVVLL 77
            .:.      :..:||:.|||:
  Rat    75 YKSTKRNIPMLFVRGDGVVLV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 24/86 (28%)
Lsm3NP_001100081.1 LSm3 16..97 CDD:212477 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.