DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and lsm1

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_595520.1 Gene:lsm1 / 2540520 PomBaseID:SPBC3D6.08c Length:140 Species:Schizosaccharomyces pombe


Alignment Length:125 Identity:60/125 - (48%)
Similarity:86/125 - (68%) Gaps:2/125 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLAGTAHLLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIR 70
            |...:..|::.||:|::|:||||:.|||.|||.||||||:||.|||||:|.:.||||.|||:|:|
pombe     9 PFTTSGSLVDYVDRKVIVVLRDGKKLIGILRSFDQFANLMLQYTIERIYVDDMYGDIDRGVYIVR 73

  Fly    71 GENVVLLGEIDREKEQKL--PLKEISVDEILDAQRREQEQRQEKHRLVSKALKERGLAVD 128
            |||||||||:|.:||...  .|:.:..:|:....:..:|::::..|...|.|...|.:||
pombe    74 GENVVLLGELDLDKEYDAVKQLRRMPAEELYPLAKLHEEEKKKNIREKGKYLHSVGFSVD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 46/72 (64%)
lsm1NP_595520.1 LSm1 10..83 CDD:212475 46/72 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2012
eggNOG 1 0.900 - - E1_KOG1782
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40945
Inparanoid 1 1.050 114 1.000 Inparanoid score I1544
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004320
OrthoInspector 1 1.000 - - oto101330
orthoMCL 1 0.900 - - OOG6_102846
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R665
SonicParanoid 1 1.000 - - X3053
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.