powered by:
Protein Alignment LSm1 and lsm7
DIOPT Version :9
Sequence 1: | NP_611559.1 |
Gene: | LSm1 / 37413 |
FlyBaseID: | FBgn0261067 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_588340.1 |
Gene: | lsm7 / 2538964 |
PomBaseID: | SPCC285.12 |
Length: | 113 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 37/72 - (51%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 DKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERI---HVGNEYGDIPR-GVFIIRGENVVLLG 78
|:::......||.:.|.|:..||..||||....|:: ..|...|.|.: |:.::||..:||:.
pombe 33 DQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIA 97
Fly 79 EIDREKE 85
.:|..:|
pombe 98 PMDGSEE 104
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
LSm1 | NP_611559.1 |
LSm1 |
7..80 |
CDD:212475 |
20/65 (31%) |
lsm7 | NP_588340.1 |
LSm7 |
22..109 |
CDD:212476 |
22/72 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.