DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and lsm-1

DIOPT Version :9

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_496385.1 Gene:lsm-1 / 174700 WormBaseID:WBGene00003076 Length:125 Species:Caenorhabditis elegans


Alignment Length:128 Identity:54/128 - (42%)
Similarity:75/128 - (58%) Gaps:20/128 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDLNP-LAGTAHLLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPR 64
            ||..:| |.|...|.|::||||:|:|||||.|||:|||:||||||:|:..:||..|...:.:..:
 Worm     1 MDLPDPYLPGAISLFEQLDKKLLVVLRDGRKLIGFLRSIDQFANLILEDVVERTFVEKYFCETGQ 65

  Fly    65 GVFIIRGENVVLLGEIDREKEQKLPLKEISVDEILDAQRREQE--------------QRQEKH 113
            |..:||||||.|.||||...|  ..|.::|.:|.   :|.|.|              ::.|:|
 Worm    66 GFMLIRGENVELAGEIDDTIE--TGLTQVSPEEF---RRLEDEYIAKNPPKFLKRQAEKTEEH 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 39/72 (54%)
lsm-1NP_496385.1 LSm1 8..81 CDD:212475 39/72 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159806
Domainoid 1 1.000 74 1.000 Domainoid score I5984
eggNOG 1 0.900 - - E1_KOG1782
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40945
Inparanoid 1 1.050 86 1.000 Inparanoid score I3734
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55192
OrthoDB 1 1.010 - - D1508864at2759
OrthoFinder 1 1.000 - - FOG0004320
OrthoInspector 1 1.000 - - oto18510
orthoMCL 1 0.900 - - OOG6_102846
Panther 1 1.100 - - LDO PTHR15588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R665
SonicParanoid 1 1.000 - - X3053
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.