DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm1 and snr-7

DIOPT Version :10

Sequence 1:NP_611559.1 Gene:LSm1 / 37413 FlyBaseID:FBgn0261067 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_491032.1 Gene:snr-7 / 171834 WormBaseID:WBGene00004920 Length:77 Species:Caenorhabditis elegans


Alignment Length:70 Identity:22/70 - (31%)
Similarity:38/70 - (54%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIRGENVVLL 77
            |.:.:||::.:.|...|.:.|.||..|.|.|:|:...:|....|   |.:..|:.:|||.:||::
 Worm     9 LKKYMDKEMDLKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDG---GSVNLGMTVIRGNSVVIM 70

  Fly    78 GEIDR 82
            ...:|
 Worm    71 EPKER 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm1NP_611559.1 LSm1 7..80 CDD:212475 21/66 (32%)
snr-7NP_491032.1 Sm_G 5..74 CDD:212466 21/67 (31%)

Return to query results.
Submit another query.