DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:325 Identity:64/325 - (19%)
Similarity:112/325 - (34%) Gaps:133/325 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSNHRPLD-----------DSDILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISI 54
            |:..|:|..           |:::||. .:.|...|:|.....::.::|||..|..:||.:.:.:
Zfish    11 MAPIHKPTHYSVRRSMVVKMDAELLLF-LVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDV 74

  Fly    55 SDARRRWTCLRDRYSRELKQKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGW 119
            .:.:.:|..|||.|:|   :|||...|                      .|.||.. :::|...:
Zfish    75 EEVKAKWKNLRDTYTR---KKRLEQDG----------------------SRSGRAA-KKKKQWKY 113

  Fly   120 MKV----DLQRRRRTRLPIDTETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDG 180
            |:|    |.....|:.:                        .|:|:|               || 
Zfish   114 MRVMDFLDPATEHRSGI------------------------LDSKIE---------------DD- 138

  Fly   181 QEPEQESFDEFLGDAECEQKVKVVTIHPEIAAPNATSAPEPIESNHADLNYLVCMPPNANQEREH 245
             ||:::|.                      |.|.:||....:.|..|..:.:|        :|..
Zfish   139 -EPDEDSG----------------------AEPASTSTGTSVTSPEAMRSSIV--------KRRR 172

  Fly   246 SAPELPNPTAVITQKTCETED--------------DFFCKSIAAYLRQLSRVHKIKAKVEMYQIL 296
            |      .|..:.:|...|:|              |.|.:|:|..||:|....:...|:::.:||
Zfish   173 S------ETLELLEKYLATKDAKDREKDEQQQDEVDLFLRSLAPALRRLPASKQSLVKLQIQKIL 231

  Fly   297  296
            Zfish   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 20/82 (24%)
BESS 264..298 CDD:281011 12/47 (26%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 27/113 (24%)
BESS 199..233 CDD:308542 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.