DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and Adf1

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:316 Identity:63/316 - (19%)
Similarity:109/316 - (34%) Gaps:84/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELK--- 73
            |:.||:.::..|.:||....:::...||.:.|.::|:.|.:......:||..|||:::||:|   
  Fly    13 DLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQ 77

  Fly    74 QKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTET 138
            :.|..         :|::|.||.|.:|:.||                                  
  Fly    78 ESRWR---------YFKQMQFLVDSIRQYRE---------------------------------- 99

  Fly   139 LIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESF-----DEFLGDAECE 198
                                :.|......|::.:.|.:....|:.:|::.     ..|.|.|...
  Fly   100 --------------------SLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTS 144

  Fly   199 QKVKVVTIHP-EIAAPNATSAPEPIESNHADLNYLVCMPP--NANQEREHSAPELPNPTAVI--- 257
            .:   ...|| ||...:.......:..:.....|   .||  ....|.||| ..:.|...:.   
  Fly   145 AQ---ALTHPHEITVTSDAQLATAVGKDQKPYFY---EPPLKRERSEEEHS-DNMLNTIKIFQNN 202

  Fly   258 TQKTCETEDDFFCKSIAAYLRQLSRVHKIKAKVEMYQILEKYILLEECGKGSGAGG 313
            ..:....||..|...:...|..|....|.:|||.:.:.|....||.:..|. .:||
  Fly   203 VSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNKYXLSGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 23/85 (27%)
BESS 264..298 CDD:281011 10/33 (30%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.