DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and hng2

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:326 Identity:60/326 - (18%)
Similarity:108/326 - (33%) Gaps:107/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NHRPLDDSDILL-------IQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDAR--- 58
            ||:.|..:...|       |..:.:...:::...|:|...:.::|.|.::...|..:..|:.   
  Fly     3 NHKVLRSAGSNLRYSMYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPE 67

  Fly    59 ---------RRWTCLRDRYSRELKQKRLHPSGE---FGHNDFFRKMDFL-------RDFVRKRRE 104
                     :||...||.|   |:..||..|||   .....:.:::.||       .|.|...:|
  Fly    68 KQEIVKTLLKRWKNTRDSY---LRVNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLKE 129

  Fly   105 RRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSE 169
            :...:..|::..|...:.....|:|                    ..:::.:.:..:.:....|.
  Fly   130 QPKPQAKRKRVSTAAQRSAKTPRKR--------------------NSDQESNIEPAIRNPAIPSN 174

  Fly   170 TYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIHPEIA-APNATSAPEPIESNHADLNYLV 233
            ..:|                  |||..|   .|..|..|||| .|...|.| |..:|.|   ||.
  Fly   175 INTV------------------LGDLGC---AKEDTATPEIAYIPQLPSDP-PCSTNTA---YLS 214

  Fly   234 CMPPNANQEREHSAPELPNPTAVITQKTCETEDDFFCKSIAAYLRQLSRVHKIKAKVEMYQILEK 298
            ..|                             |..|..:|..:::|:....|:..::|:.:||..
  Fly   215 ADP-----------------------------DQAFFDTIKPHMQQMCADRKLDFQIEVLKILRN 250

  Fly   299 Y 299
            :
  Fly   251 F 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 21/111 (19%)
BESS 264..298 CDD:281011 8/33 (24%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 18/94 (19%)
BESS 216..250 CDD:281011 9/62 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.