DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and CG8765

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster


Alignment Length:368 Identity:73/368 - (19%)
Similarity:133/368 - (36%) Gaps:119/368 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISD--ARRRWTCLRDRYSRELKQ 74
            :::||..:.:..|||:|:.|.:|.::.|:|.|.::..  |:..||  .:.:|..:||:|.|||  
  Fly    39 ELILISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGS--NVGWSDVQCKSKWKAMRDQYCREL-- 99

  Fly    75 KRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPIDT--- 136
            ||.....:.....:|:::||||.:. ..|..|||.........|.:       ....||:.|   
  Fly   100 KRAKACSKAVKWKYFKELDFLRPYA-LARNYRGRSGQTSNGAVGTV-------TPLSLPMTTSFS 156

  Fly   137 ---------------------ETLIEE-----------------QGSH-----AYDEGEEQHDYD 158
                                 .||::.                 ..||     ...:.::||   
  Fly   157 SNSSSQNLNLSGSIKIEDASASTLLDSCSFSSPSSTDKKPAATFLASHIGAVLQQQQQQQQH--- 218

  Fly   159 AKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIHPEIA----APNATSAP 219
             :.:.|:.....::.:.:|..|..|   |.....|.|.....|.  |::.||.    |.|.:|:.
  Fly   219 -QQQMHSQPEANWNYLTDAGGGATP---SIIVQCGTANTTTVVD--TLYNEIVDCVNAANQSSSA 277

  Fly   220 EPIESNHADLNYLVCMPPNANQEREHSAPELPNPTAVITQKT-CETEDD-----------FFCKS 272
            ..|.||                        :...:|...|.| .|.|||           :|.|.
  Fly   278 ATITSN------------------------VSTTSAAHNQSTNAEEEDDDPIHTFLNMESYFEKE 318

  Fly   273 IAAYLRQLSRVH--------KIKAKVEMYQILEKYI--LLEEC 305
            :...::|...::        ..|.|:|:::.:.:.:  .:::|
  Fly   319 LITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 28/84 (33%)
BESS 264..298 CDD:281011 9/52 (17%)
CG8765NP_649141.1 MADF 42..123 CDD:214738 28/84 (33%)
MADF 318..405 CDD:214738 5/44 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.