DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and CG13204

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:52/106 - (49%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKRLHPS 80
            |:.:::...:|:...|.::..:.|.:.|.::||.:.:|:..::|:|..|||.|::.|:..|:...
  Fly    24 IEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYLRSFRVGTK 88

  Fly    81 GE-----FGHNDFFRKMDFLRDFV---RKRRERRGRERDRE 113
            ..     :.|.|   .||||:.|.   |......|:..|.:
  Fly    89 TSKKYQYWAHAD---HMDFLKPFQGPGRNSANGNGKSNDED 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 22/86 (26%)
BESS 264..298 CDD:281011
CG13204NP_610678.1 MADF 22..108 CDD:214738 22/86 (26%)
BESS 478..510 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.