DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and CG7745

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:213 Identity:45/213 - (21%)
Similarity:76/213 - (35%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DILLIQTIRETPSLYDPQLPSFRLS--------QRKEEDWAKVADLLNISISDARRRWTCLRDRY 68
            |..||..:.:...:|:.|  .:.|:        :.|:|.|..:|..|...:...::||..||:||
  Fly     3 DEQLIDEVAQHGVIYNRQ--KYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERY 65

  Fly    69 SRELKQKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERR---------------GRERDREQKPTG 118
            ..:.||.. .|..|.....:..||.||...::.|:..|               |....:..|..|
  Fly    66 VSQRKQGD-PPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSNG 129

  Fly   119 WMKVDLQRRRRTRLPIDTETLIEEQGSHAYDEGEEQHDYDA--KLESHTTQSETYSVVVEADDGQ 181
            .||             :.........||.|.:.::||...|  .:.:...::....|.:|||   
  Fly   130 SMK-------------NVSQFGSSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEAD--- 178

  Fly   182 EPEQESFDEFLGDAECEQ 199
                :.|.:|......:|
  Fly   179 ----QVFRDFAAAVASQQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 24/90 (27%)
BESS 264..298 CDD:281011
CG7745NP_610671.1 MADF 5..96 CDD:214738 24/93 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.