DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and CG10949

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:331 Identity:76/331 - (22%)
Similarity:128/331 - (38%) Gaps:83/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSNHRPLDD------SDIL---LIQTIRETPSLYDPQLPSFRLSQR---KEEDWAKVADLLNIS 53
            |....|..|:      .|:|   ||:.::..|.|||..  ..|:|:.   |.|.|.::::.||:|
  Fly   118 MEQERRRKDEEEEDSQDDLLNEQLIELVKSHPVLYDRH--KIRVSKNLAAKNEAWREISENLNVS 180

  Fly    54 ISDARRRWTCLRDRYSRELKQKRLHPSGEFGHNDFFRKMDFLRDFVRK-------RRERRGRERD 111
            ......||..||||:.||.:..:::.|...... :|..:.||....||       ..:||||. .
  Fly   181 EELCYNRWKKLRDRFGREFRSHQINQSTPITWR-YFNDLLFLGRHFRKGVPLVLENIKRRGRP-P 243

  Fly   112 REQKPTGWMKVDLQRRRRTRLPIDTETLIEEQGSHAY--------------DEGEEQHDYDAKLE 162
            :...|:|         :.::.|   |.::...|...:              |:.|..:|.:.::.
  Fly   244 KAGNPSG---------KTSKQP---EGMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEIL 296

  Fly   163 SHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIHPEIAAPNATSAPEPIESNHA 227
            |...|:..|..::.....::           |.|..|:::|.|..|      |||  |.|....|
  Fly   297 SEAEQATPYDFILSEATARQ-----------DLEPPQQLQVTTTTP------ATS--EEIIHTIA 342

  Fly   228 DLNYLVCMPPNANQEREHSAPELPNPTAVITQKTCETEDDFFCKSIAAYLRQLSRVHKIKAKVEM 292
            .:|.:|        |...|.|....|:|.|:.|...|       .||.....|.:..:::|::..
  Fly   343 RVNPVV--------EESSSLPGDSVPSAAISDKLLTT-------VIANMETVLQQSRELQAQIHH 392

  Fly   293 YQILEK 298
            .|..|:
  Fly   393 EQEQER 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 26/85 (31%)
BESS 264..298 CDD:281011 6/33 (18%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 26/88 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.