DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and madf-9

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:325 Identity:70/325 - (21%)
Similarity:130/325 - (40%) Gaps:68/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSNHRPLDDS---DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTC 63
            ||.:..::::   :|.||..::..|.|||.....:.|...:...|.::|:.|..:....:.||..
 Worm    37 SSKNMKIEETPVFNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKT 101

  Fly    64 LRDRYSRELKQKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQ-------KPTGWMK 121
            |||||.:|.|::|:  |.:.....|.|.:.|::..:   ::|...|.|..|       :|.|.:.
 Worm   102 LRDRYKKEEKKERV--SKKASSWVFQRPLKFIQAHL---KDRHTDETDSNQSEPAVKPEPNGHVS 161

  Fly   122 VDLQRRRRTRLPIDTETLIEEQGSHAYDEGEEQHDYDAKLESHTT---QSETYSVVVEADDGQEP 183
                       |:        :.:.::.|.|.....|:...|.:|   :|.:.|....|...:..
 Worm   162 -----------PM--------EAAMSFIENELIRTQDSSKSSGSTGEMESSSASTASSASSSKNT 207

  Fly   184 -EQESFDEFLGDAECEQKVKVVTIHPEIAAPNATSAPEPIESNHAD----------LNYLVCMPP 237
             .||.     |:|      .|:| .|.:..|.|.: |.|..::.|.          ::....|.|
 Worm   208 GTQEG-----GEA------SVIT-PPPLPIPMAVT-PSPSATSSASNGGPAVKRSRVSITEGMTP 259

  Fly   238 NANQEREHSAPE------LPNPTAVITQKTCETEDDFFCKSIAAYLRQLSRVHKIKAKVEMYQIL 296
            .|::....:|..      .|..:...|.:. |.||:.|.:.|:..|.:|....|..||:::.:.:
 Worm   260 VASRNAAAAAAASLGLSFFPGLSQWATTRE-EEEDEIFARMISIKLSKLDARTKEVAKLQVLKAI 323

  Fly   297  296
             Worm   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 24/82 (29%)
BESS 264..298 CDD:281011 9/33 (27%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.