DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and madf-3

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:335 Identity:66/335 - (19%)
Similarity:122/335 - (36%) Gaps:91/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDAR---RRWTCLRDRYSRELK 73
            ::.||:.:|.:..|:|.....:|.::.|...|.::..:|... .|.|   .||..|||:|.:|.:
 Worm     7 NLRLIEAVRHSRCLFDNTDRQYRNTEYKNRVWQRLVTVLGFD-GDPRMLSARWKQLRDKYGKEKR 70

  Fly    74 QKRLHPSGEFGHN----DFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPI 134
            :::      :|:.    .:|:.:.||...:..|.|.....::    |||       ...:...|.
 Worm    71 KQK------YGNEKSSWQYFKHLHFLDPHMTDRAEISPSRKE----PTG-------VHEKIAEPC 118

  Fly   135 DTETLIEEQGSH--AYDEGEEQHDYDAKLESHTTQSETYSVVVE--ADDGQEPE-----QESFDE 190
            ..:.||.|...|  .||.      .|.|......:::.:.::::  ...|..|.     ::..|.
 Worm   119 FGKNLILEVRRHPCLYDV------RDPKYRHGDCRTQAWGMIIDKLRYPGTVPSIYKQWKKHRDR 177

  Fly   191 F---------LGDAECEQKVKVVTIHPEIA--------------------APNATSAPEPIESNH 226
            :         |||... |.|....::.::|                    ..|.....:...|::
 Worm   178 YVREKRRLRNLGDPNV-QDVSTWEMYDDMAWIDQHLDEQQLSRCARSLKRGGNNDGGNQDEMSDY 241

  Fly   227 A----DLNYLVCMPPNANQEREHSAPELPNPTAVITQKTCETEDDFFCKSIAAYLRQLSRVHKIK 287
            .    |:||::            .|.:.||...|:..     .|..|..||.:.||.|....:|.
 Worm   242 GDYDDDINYVM------------MAEKRPNNGDVLLD-----GDSAFSASIVSDLRTLGEEARII 289

  Fly   288 AKVEMYQILE 297
            ||.::..:||
 Worm   290 AKQQIMILLE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 22/89 (25%)
BESS 264..298 CDD:281011 12/34 (35%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 22/91 (24%)
MADF 122..212 CDD:214738 17/96 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.