DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and madf-8

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_497739.1 Gene:madf-8 / 183517 WormBaseID:WBGene00008118 Length:300 Species:Caenorhabditis elegans


Alignment Length:84 Identity:21/84 - (25%)
Similarity:35/84 - (41%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISD----ARRR--WTCLRDRYSRELK 73
            :|..:|:.|.|:|.:|...|.|......|.::.  |.:.|.:    |||:  |...||.:...:.
 Worm   136 IIYAVRKRPILWDQRLICHRNSNLSRRAWDQLD--LELGIDEEYPLARRKQIWKSKRDYFVSAVN 198

  Fly    74 QKRLHPSGEFGHNDFFRKM 92
            ...|.........:|:|.|
 Worm   199 AANLRKWIYADALEFYRPM 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 21/84 (25%)
BESS 264..298 CDD:281011
madf-8NP_497739.1 MADF 135..219 CDD:214738 21/84 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.