DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and madf-4

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:344 Identity:82/344 - (23%)
Similarity:136/344 - (39%) Gaps:83/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSNHRPL-DDSDILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISIS------DARR 59
            |.||.|| ||..:.||.:::..|.:|:...|..:::..|.|.|    .|::|.|.      :..|
 Worm     8 SPNHDPLEDDFTLALIDSVQRNPCVYNRYDPLHKVTDYKHEIW----KLISIEIGYDGQPVELER 68

  Fly    60 RWTCLRDRYSRELKQ-KRLHPSGEFGH-NDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKV 122
            :|..:||:|.|..|| |:..|..:... .:::.||.||..:|    |.|.|:|.::.        
 Worm    69 KWKHMRDKYVRLRKQDKQKAPIKKTNKWYNYYHKMSFLDPYV----EHRNRKRQKDY-------- 121

  Fly   123 DLQRRRRTRLPIDT---------ETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETY------- 171
             |.......|..||         |.|..|....:.|.|     |::   .|||.|.:.       
 Worm   122 -LNSNTPDFLDDDTAFLDGLSVKEMLKPESLLTSNDAG-----YNS---PHTTSSSSSSGSNNNG 177

  Fly   172 ----SVVVEADDGQEPEQESFDEFLGD-AECEQKVKVVTIHPE-----------------IAAPN 214
                |..::.:|.::.....:|:|:.: .|.|:..:....|.:                 ..||:
 Worm   178 RFLDSPTIDIEDDKKNLALIYDKFVANQTENEKNHRFSNKHGKDLLFSTTNTLIEKLATTSTAPS 242

  Fly   215 ATSAPEPIESNHADLNYLVCMPPNANQEREHSAPELPNPTAVITQKTCETEDDFFCKSIAAYLRQ 279
            ::...:||     .:..|...||  .||:......|.:    |..:..|.:...|.:|||..|..
 Worm   243 SSRKRKPI-----PVQILPSSPP--PQEKNTKIELLED----ILNEPNEDQVSLFVRSIARTLND 296

  Fly   280 LSRVHKIKAKVEMYQILEK 298
            |.|.....|:||:.::|.|
 Worm   297 LDREKFAMARVEISKVLYK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 25/90 (28%)
BESS 264..298 CDD:281011 11/33 (33%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4094
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.