DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and madf-5

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 / 175118 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans


Alignment Length:394 Identity:82/394 - (20%)
Similarity:136/394 - (34%) Gaps:133/394 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLL--NISISDARRRWTCLRDRYSRELKQKRL 77
            ||..:|:.|.||:........:..::..|..:|..:  |.:...|::||..|||||.:|||... 
 Worm    11 LINEVRKYPCLYNHSRRGSGDTMERQRLWESIAKNIDPNCAAEFAKKRWLQLRDRYRKELKIAI- 74

  Fly    78 HPSGEFGHNDF--------FRKMDFLRDFVRKRRERRGRERDREQK-------------PTGW-- 119
                   .|.|        |.::.:|..|:   ::..|:..|..:|             |..|  
 Worm    75 -------KNGFVTPVRWCYFNQLSWLDPFL---KDNIGQAADEGKKTGKSDSFDEPSGTPFSWFG 129

  Fly   120 ----------MKVD-------------LQRRRRTRL-PIDTETLIEEQGSHAYD--------EGE 152
                      |:.|             |..:...|| .|..|...:|.|:.:.|        :|:
 Worm   130 FPNLNSIKDEMEDDDSDPALESSVLDRLLAQTAQRLDSISPEIENDESGTQSLDGNLDGVDGDGD 194

  Fly   153 EQHDYDAKLESHT---------TQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIHP 208
            |:.|...|.|...         :|||..:::.||...|..:|..      .|:..|:|:.....|
 Worm   195 EEEDLKIKDEDEVEEDGPEKVKSQSEAMAMLKEAISAQSQQQTQ------QAQQVQQVQQTPQKP 253

  Fly   209 E----IAAPNATSAPEPIESNH--ADLNYLVCMPPNANQEREHSAPEL----PNPTAVIT----- 258
            .    |||..|..|      :|  |.|..:..|...|.:..|.:.|.|    |.|||..|     
 Worm   254 SVESLIAANQARFA------HHLAAQLTGMSSMLNGARKSEEAAIPPLRPSTPPPTASTTSHFHP 312

  Fly   259 ----------QKTCET-------------------EDDFFCKSIAAYLRQLSRVHKIKAKVEMYQ 294
                      |:|.:.                   ||..:.:.|...|:::....:.|.:.::..
 Worm   313 YKEAARNRHRQQTADNVMRYHLQQVGRVALEWLNDEDLLYSRIIGLKLKKMDPKKRKKVRHQIMS 377

  Fly   295 ILEK 298
            :|::
 Worm   378 LLDE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 24/92 (26%)
BESS 264..298 CDD:281011 6/52 (12%)
madf-5NP_497028.1 MADF 10..98 CDD:214738 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.