DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and LOC110439798

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:294 Identity:67/294 - (22%)
Similarity:112/294 - (38%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRE-----LKQ 74
            |::.:...|.|::.....:|.::|:|..|..||..:.:|:.:.:|||..:||||.||     ||:
Zfish    32 LLRAVYRIPLLHNRLRTDYRSTERRERVWRDVAASIGLSVVECKRRWKTIRDRYIRERRLCKLKK 96

  Fly    75 ----KRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPID 135
                :|||   .:.|.:   .:.||...:||||...|.:...|::.                   
Zfish    97 DLGGRRLH---YWPHRE---SLAFLDAHIRKRRRPSGAQGPEEEQQ------------------- 136

  Fly   136 TETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQK 200
                 ||..|.|..|.:|:          ..|.|..|..........|...|....|........
Zfish   137 -----EEHSSAALQEDKEE----------CVQEECVSDSSRFVSPLNPLPLSIVTQLKPVPQVSP 186

  Fly   201 VKVVTIHPEI-AAPNATSAPE--PIESNHADLNYLVCMPPNANQEREHSAPELPNPTAVITQKTC 262
            :.:.::.|.: .||.::|||.  |..::...||.     |...|:|...|.:             
Zfish   187 LLLTSLPPGLKVAPASSSAPPLLPASASAGPLNV-----PLEEQQRADGALD------------- 233

  Fly   263 ETEDDFFCKSIAAYLRQLSRVHKIKAKVEMYQIL 296
              ||..|..|....|::|:...:...|:::.||:
Zfish   234 --EDQLFLLSYVPALKRLTPQKRAAVKMQIQQIM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 27/91 (30%)
BESS 264..298 CDD:281011 9/33 (27%)
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 27/93 (29%)
BESS 233..267 CDD:308542 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.