DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and LOC110438041

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_021323091.1 Gene:LOC110438041 / 110438041 -ID:- Length:277 Species:Danio rerio


Alignment Length:310 Identity:59/310 - (19%)
Similarity:113/310 - (36%) Gaps:64/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDDSDILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSREL 72
            |.:.:..|.:.:|....:|||.|......:..:..|..::.....:.:..|:.|..|||::.| :
Zfish     3 LSNFEKTLAENVRRHRIIYDPNLHDHGDLELTQSAWNDISAATGKNEAVCRKAWKNLRDKFVR-I 66

  Fly    73 KQKRLHPSGE--FGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPT--GWMKVDLQRRRRTRLP 133
            |:| :|.:.:  ..:.....::.:|..:| |.||:....:|..:..|  .:||.|       .|.
Zfish    67 KRK-IHTNSKDPGSYRKIVAELGWLCQYV-KHREKSLNAKDGCKGVTFEEFMKTD-------NLQ 122

  Fly   134 IDTETLIEEQGSHAYDEGEEQHDYDAKLE-------SHTTQSETYSVVVEADDGQEPEQESFDEF 191
            :.:.:...|.|:         .|..:.|.       ..|....|.|.:|.|.....|..      
Zfish   123 MSSASGTSETGT---------SDNPSPLSLMPSSPVPSTPVLPTQSTLVPATSSTPPPP------ 172

  Fly   192 LGDAECEQKVKVVTIHPEIAAPNATSAPEPIESNHADLNYLVCMPP----------NANQEREHS 246
            ...::|         :|.....:|.|.|....|.:|..:....||.          |..::.|.:
Zfish   173 CPSSKC---------YPSPCLVSAFSVPNISPSPNASPSSSELMPKRKSTSEACLLNMLEQMEWT 228

  Fly   247 APELPNPTAVITQKTCETEDDFFCKSIAAYLRQLSRVHKIKAKVEMYQIL 296
            ..:.|:.         ::||..|...:...|.::....|.:.|.::||:|
Zfish   229 REKTPHQ---------DSEDFRFASVVVDMLAKIDPRMKSEVKFKIYQML 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 17/84 (20%)
BESS 264..298 CDD:281011 9/33 (27%)
LOC110438041XP_021323091.1 MADF_DNA_bdg 10..77 CDD:313715 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.