DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:216 Identity:46/216 - (21%)
Similarity:78/216 - (36%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISD-ARRRWTCLRDRYSRELKQKRLHPS 80
            :.::..|.|||..|..|::.::....|.::|..|.|...: .:..|..:||::|:.:  ||:...
Zfish    10 ELVKLYPHLYDHSLRDFKVPEKVFNSWKEIATKLGIDNPETCKSTWRNIRDKFSKAM--KRMLRK 72

  Fly    81 GEFGHND-----FFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLI 140
            |  |..|     .|.::.:||.|||.|.        .....|...:.::|.....:      .::
Zfish    73 G--GDEDARVPRLFVELKWLRPFVRLRA--------NTVSDTPCFEFEIQNEETPK------NMV 121

  Fly   141 EEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEF-------LGDAECE 198
            .|:.|.:               |..|.        |:|........|.|.|       |....||
Zfish   122 AEESSSS---------------SGCTN--------ESDVEGRCSAASLDAFGTSALHRLSSTPCE 163

  Fly   199 QKVKVVTIHPEIAAPNATSAP 219
                  .:...||.|:.:|||
Zfish   164 ------AVTSTIAQPSPSSAP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 22/86 (26%)
BESS 264..298 CDD:281011
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.