DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng1 and LOC100330838

DIOPT Version :9

Sequence 1:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:284 Identity:58/284 - (20%)
Similarity:96/284 - (33%) Gaps:96/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKRLHP 79
            ||..:.:.|.||:..:.|::.:.||.:.|..|:..:.|...|.||||..|||.:.::.:.::...
Zfish     9 LIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQRRR 73

  Fly    80 SGEFGHND--FFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLIEE 142
            :....|..  :..:|.||..|::.|                                        
Zfish    74 ASGTSHRSWKYSWQMSFLTPFIQSR---------------------------------------- 98

  Fly   143 QGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIH 207
              |.|.||.||..|.:.|.|..|....:..||              .:|.||            |
Zfish    99 --SLAADEPEEDRDDEDKDEERTADGNSAFVV--------------QDFEGD------------H 135

  Fly   208 PEIAAPNATSAPEPIESNHADLNYLVCMPPNANQEREHSAPELPNPTAVITQKTCETEDDFFCKS 272
            ..:...:..||.....|......::     .||:                     :.||:.|..|
Zfish   136 GMLDGASHYSASGSQGSGRKRKWHM-----EANE---------------------DLEDEMFLFS 174

  Fly   273 IAAYLRQLSRVHKIKAKVEMYQIL 296
            :..|||:|....|...|::::|:|
Zfish   175 LLPYLRRLPYAKKSAVKLKIHQLL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng1NP_611558.2 MADF 15..98 CDD:214738 23/84 (27%)
BESS 264..298 CDD:281011 12/33 (36%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 24/86 (28%)
BESS 167..200 CDD:397204 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.