DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4266 and nonA

DIOPT Version :9

Sequence 1:NP_001097394.1 Gene:CG4266 / 37411 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_727962.1 Gene:nonA / 32603 FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster


Alignment Length:351 Identity:96/351 - (27%)
Similarity:128/351 - (36%) Gaps:109/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   794 PQQQANFNPSPSNVDLSPAAMANEMFQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAE 858
            ||:|...|           ..||:...:.:.::..|:.|........|:||.:  .:...:.:.:
  Fly    16 PQRQQRGN-----------QQANKNLGKHNAQKQNDSADGGPAEKKQRFGGPN--AQNQNQNQNQ 67

  Fly   859 NGGGGGGPGSGLGPNAAFNEARARLNLNPIEHGMPRPDFMDFDNRGGPGGPRGMGPRGNHNGGGP 923
            |||..||.|:..|||...|..                     :|:||..|.|..    |:|..|.
  Fly    68 NGGVTGGGGAVGGPNQNKNFG---------------------NNKGGFVGNRNR----NNNRAGN 107

  Fly   924 GGDFFPPNMNHN--------RFNQPTSLMQMRIPPPASFNQRMGGPAGNGG-------------- 966
            ....||.|.|.|        :.:.|.:|.:...|..|:..|.......|.|              
  Fly   108 QNRTFPGNNNPNQKPNNETSKADGPNALAKNNEPATAAAGQNQANQNANKGQNQRQGQNQNQNQV 172

  Fly   967 NGVGPMFMRNQG--GGPGGAGPSG--GGPGGAGTGGGGPG------GRQQGPGFF-NPRNPFNDN 1020
            :|.|     |||  |..||||..|  |..||||..|.|.|      |..||.||. .|:|...||
  Fly   173 HGQG-----NQGGPGNQGGAGNQGGQGNQGGAGNQGNGQGFRGRNAGNNQGGGFSGGPQNQQRDN 232

  Fly  1021 QRGRGGQSGGGVRG------VGGGGGGGPGGRGRWSDDEDEGGNNF---KRRGGPGGP------- 1069
            :...|.:.|||..|      :|||||||.||..|       ||.:|   :|.....||       
  Fly   233 RNRSGPRPGGGAGGAMNSTNMGGGGGGGGGGGPR-------GGEDFFITQRLRSISGPTFELEPV 290

  Fly  1070 ---------GGNR-FRGERGGEMMDD 1085
                     |.|| :.|....::.||
  Fly   291 EVPTETKFSGRNRLYVGNLTNDITDD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796
RRM_SCAF4_SCAF8 490..566 CDD:240673
DUF2413 1147..>1254 CDD:287302
Herpes_DNAp_acc <1206..1304 CDD:282746
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 5/16 (31%)
RRM2_p54nrb_like 377..456 CDD:240779
NOPS_NONA_like 447..546 CDD:240580
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.