Sequence 1: | NP_611553.1 | Gene: | Hmg-2 / 37407 | FlyBaseID: | FBgn0026582 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350372.1 | Gene: | Hmgb2 / 97165 | MGIID: | 96157 | Length: | 210 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 44/200 - (22%) |
---|---|---|---|
Similarity: | 82/200 - (41%) | Gaps: | 42/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PESPVSLPIASQ----------SMDTATIEDFDEDKPAKGKKKAKN---PKGRHSDSDIGSELKK 64
Fly 65 LAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAA 129
Fly 130 AKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQS 194
Fly 195 EDPDD 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmg-2 | NP_611553.1 | HMGB-UBF_HMG-box | 76..141 | CDD:238686 | 18/64 (28%) |
Hmgb2 | NP_001350372.1 | HMG-box | 7..78 | CDD:320749 | 8/45 (18%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..102 | 12/43 (28%) | |||
HMG_box | 95..162 | CDD:278906 | 18/66 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 162..210 | 9/56 (16%) | |||
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 | 165..180 | 2/19 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3288 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |