DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and ABF2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_013788.1 Gene:ABF2 / 855094 SGDID:S000004676 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:47/256 - (18%)
Similarity:84/256 - (32%) Gaps:113/256 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIE 127
            |:...|...:...||.|.:.|..::.|.|.:..:|.|.....|.::|.||:|..|..:.|..|| 
Yeast    30 KRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKIAGEKWQNLEADIKEKYI- 93

  Fly   128 AAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKR 192
              ::.|.:|                :|..||||  :.|    ||.                    
Yeast    94 --SERKKLY----------------SEYQKAKK--EFD----EKL-------------------- 114

  Fly   193 QSEDPDDVPLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPGEIPIYTNEFIEHNRST 257
                                ||..||.|                             ||::    
Yeast   115 --------------------PPKKPAGP-----------------------------FIKY---- 126

  Fly   258 ENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGEVTELMEE---NQRLETYLRALRQ 315
            .||:|            :.|..||.|.::....|::|:..:.:::   ::.::.|.:|:::
Yeast   127 ANEVR------------SQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/64 (30%)
ABF2NP_013788.1 NHP6B 1..183 CDD:227935 47/256 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.