DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and RUD3

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_014859.3 Gene:RUD3 / 854391 SGDID:S000005742 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:414 Identity:89/414 - (21%)
Similarity:156/414 - (37%) Gaps:96/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KGKKK-AKNPKGRHSDSDIGSELKKLAQ--RRINVAGAPKM----PLNGYVRFMNDRREELRREQ 98
            |.||| .|..|......|:...:.|..:  ..:||...|||    ..:|.|...:|..::|....
Yeast     3 KNKKKTGKKAKSHPHVEDVDETVNKPEEIINSVNVTVPPKMSTDPEADGIVASPDDEGKDLSEGV 67

  Fly    99 PQR-----------TALEHTRIIGEEWHQLPEERKLPYIEAA-AKDKAI----YQEQLQMFLKEH 147
            .::           ..||..: .|:|..:|.||.:...:|.: .||:..    ::.:|...:||.
Yeast    68 DKQKVNDGLTVDTINPLEDKK-AGDEMKELREEIERLKLELSHKKDQETPNEDFKNELANVIKER 131

  Fly   148 PEI----------------VANELAKAKKATKLDGSPKEKTPKGESALGKAKK------------ 184
            .|.                :.|::.:|:|..:   ..:|:..:.||...|.||            
Yeast   132 DEFKTQYDTLLSKISSMKSIFNKMKEAQKQLE---EVQEQLTEYESQNLKLKKKLEATKTENSEL 193

  Fly   185 --------TKAKPVKRQSEDPDDVPLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPG 241
                    |:.:.::::.|..::|.|....|.:.................:..........||..
Yeast   194 QSTIVTLNTELENLEKEQESTEEVFLEYESRIEALEDEKHDIIEKHSKELNTYRKEKDQLNLQVQ 258

  Fly   242 EIPIYTNEFIEHNRSTENELRT----LRKAKTDLEQQNAVLE----------QHVDNTKAGYAKV 292
            |:.|    .:|:|:...::|||    ||:|....|::.|||:          :.|||.:...|:.
Yeast   259 ELMI----ILENNKQDISDLRTERDELRQALESHEKEKAVLKNSLNDLELKIEEVDNKREEEARE 319

  Fly   293 MG-EVTELMEE-NQRLETY------LRALRQKLVAALGGISMPPL--EPSGPSVGNIDKYIRHLA 347
            .. ||..|..: :..:||:      |.:::::|.|.....||...  |.|...:..|.| :||.|
Yeast   320 RDQEVKSLRSQLDTEIETHNNDTEALESMKKQLEAMKEDASMKEKYEEESKQHILQIGK-LRHEA 383

  Fly   348 GLVTQPSNVTLIKAREALRKVDTS 371
            .::    |..|.||...|:|...|
Yeast   384 IIL----NEHLTKALAMLKKSSDS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 17/84 (20%)
RUD3NP_014859.3 SMC_prok_A 88..>382 CDD:274009 61/302 (20%)
GRAB 401..449 CDD:402134 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.