DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and HMO1

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_010459.1 Gene:HMO1 / 851754 SGDID:S000002581 Length:246 Species:Saccharomyces cerevisiae


Alignment Length:257 Identity:53/257 - (20%)
Similarity:96/257 - (37%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TEPTSKTPDAVPESPVS--LPIASQSMDTA-TIEDF------DEDKPAKG--------------- 42
            |:|:.|...| .:|.||  ..::..:..|| :|.||      ||::..:.               
Yeast     3 TDPSVKLKSA-KDSLVSSLFELSKAANQTASSIVDFYNAIGDDEEEKIEAFTTLTESLQTLTSGV 66

  Fly    43 ------KKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQ--- 98
                  ..:..||.....|:.|.:.:|.:.::......|||.||..:..:....|:|||.::   
Yeast    67 NHLHGISSELVNPIDDDKDAIIAAPVKAVRRKIERDPNAPKKPLTVFFAYSAYVRQELREDRQKA 131

  Fly    99 --PQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKA 161
              |..::.|.|:.|.::|.:|.:..|       .|.|..|..:|:.:.:|     .::..:|||.
Yeast   132 GLPPLSSTEITQEISKKWKELSDNEK-------EKWKQAYNVELENYQRE-----KSKYLEAKKN 184

  Fly   162 TKLDGS-----------------------PKEKTPKGESALGKAKKTKAKPVKRQSEDPDDV 200
            ..|..:                       |.||.|..:....:.||.|.|..|::.:....:
Yeast   185 GTLPPASLENGPTHAPVPIPFSLQHAAEPPVEKRPHDDDGSSEKKKKKKKKDKKKDKSNSSI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/69 (26%)
HMO1NP_010459.1 NHP6B 36..246 CDD:227935 43/221 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2285
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.