DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Tfam

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_112616.2 Gene:Tfam / 83474 RGDID:620682 Length:244 Species:Rattus norvegicus


Alignment Length:171 Identity:48/171 - (28%)
Similarity:66/171 - (38%) Gaps:51/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPE-ERKL----------PYIEAA 129
            ||.|::.|:||..::..:.:.:.|.....|..|.|...|.:||| |:|:          .|.||.
  Rat    49 PKKPMSSYLRFSTEQLPKFKAKHPDAKVSELIRKIAAMWRELPEAEKKVYEADFKAEWKVYKEAV 113

  Fly   130 AKDKAIYQEQL-------------QMFLKEHPEIVANELAKAKKATKLDGSPKE----------- 170
            :|    |:|||             |..||:..:|...||.       |.|.||.           
  Rat   114 SK----YKEQLTPSQLMGLEKEARQKRLKKKAQIKRRELI-------LLGKPKRPRSAYNIYVSE 167

  Fly   171 --KTPKGESALGKAKKTKAKPVKRQSEDPDD--VPLAKVKR 207
              :..|.|||.||.|... :..|..|.|...  :.|||..|
  Rat   168 SFQEAKDESAQGKLKLVN-QAWKNLSHDEKQAYIQLAKDDR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 24/88 (27%)
TfamNP_112616.2 NHP6B <46..215 CDD:227935 48/171 (28%)
HMG_box 49..116 CDD:395407 20/70 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.