DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and 3xHMG-box2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:175 Identity:46/175 - (26%)
Similarity:84/175 - (48%) Gaps:39/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELR 95
            :::.::|...|.||: |:|            ||            ||.|::.::.:.|:||..||
plant   235 VQEAEQDNKKKNKKE-KDP------------LK------------PKHPVSAFLVYANERRAALR 274

  Fly    96 REQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKK 160
            .|  .::.:|..:|.||||..|.:::|.||.:.|.|:|..|.:.::.:.:...|...::..:.::
plant   275 EE--NKSVVEVAKITGEEWKNLSDKKKAPYEKVAKKNKETYLQAMEEYKRTKEEEALSQKKEEEE 337

  Fly   161 ATKLDG-------SPKEKTPKGESALGKAKKTKAKPVKRQSEDPD 198
            ..||..       ..||||   ::.:.|.|.||.|  |.::.||:
plant   338 LLKLHKQEALQMLKKKEKT---DNLIKKEKATKKK--KNENVDPN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 23/64 (36%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 46/175 (26%)
HMGB-UBF_HMG-box 139..203 CDD:238686
HMG-box 255..320 CDD:381793 23/66 (35%)
HMGB-UBF_HMG-box 379..444 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4005
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.